travel

Get Babylon's Translation Software! Free Download Now!
Babylon 8 - Your all-in-one solution
Award winning translation software trusted by millions. Translate from any language to any language.
View Demo


Wikipedia English The Free EncyclopediaDownload this dictionary
Travel
Travel is the transport of people on a trip/journey or the process or time involved in a person or object moving from one location to another. Reasons for travel include:Tourism—travel for  recreation. This may apply to the travel itself, or the travel may just be the necessary investment to arrive at a desired location.Visiting friends and familyTradeCommuting–going to various routine activities, such as work or  meetings.Migration—travel to begin life somewhere else;  nomadic people do thisPilgrimages—travel for religious reasons
See more at Wikipedia.org...
 
travel
.travel is a top-level domain approved by ICANN on April 82005, as a sponsored TLD in the second group of new TLD applications evaluated in 2004. It is restricted to the use of travel agentsairlinesbed and breakfast operators, tourism bureaus, and others in the travel industry. It is sponsored by Tralliance Corporation, a wholly owned subsidiary of TheGlobe.com.
See more at Wikipedia.org...

This article uses material from Wikipedia® and is licensed under the GNU Free Documentation License

Wikipédia FrançaisDownload this dictionary
travel
.travel est un nom générique du domaine de premier niveau réservé (théoriquement) au secteur industriel du voyage (compagnies aériennesagences de voyages, ....). Le domaine .travel a été approuvé par l'ICANN le 8 avril 2005.
Pour la suite, voir Wikipédia.org…
 
Voyage
Un voyage est un déplacement effectué vers un point plus ou moins éloigné dans un but personnel (tourisme) ou professionnel (affaires). Le voyage s'est considérablement développé et démocratisé, au cours du avec l'avènement de moyens de transports modernes et de plus en rapides et confortables, le chemin de fer d'abord, puis l'automobile et l'avion.
Pour la suite, voir Wikipédia.org…
 
Voyages
Cette page d’ répertorie les différents sujets et articles partageant un même nom. 
Pour la suite, voir Wikipédia.org…

© Cet article se sert du contenu de Wikipédia® et est autorisé sous les termes de la Licence de Documentation libre GNU

Wikipedia Deutsch Die freie EnzyklopädieDownload this dictionary
Reise
Der Begriff Reise (v. althochdeutsch: risan = aufstehen, sich erheben) bedeutet im Sinne der Verkehrswirtschaft die Fortbewewegung einer oder mehrerer Personen über eine längere Zeit zu Fuß oder mit öffentlichen bzw. nicht öffentlichen Verkehrsmitteln außerhalb des Wirtschaftsverkehrs, um ein Reiseziel zu erreichen oder mehrere Orte bis zur Beendigung der Reise am Ausgangsort kennenzulernen (Rundreise). Im fremdenverkehrswirtschaftlichen Sinne umfasst die Bezeichnung Reise die Summe der beiden Phasen "Ortsveränderung" und Aufenthalt. Die verwendeten Verkehrsmittel bilden hierbei eine Gesamtheit: Die Reisekette (Beispiel: Bus – Flugzeug – Straßenbahn – Taxi).
Mehr unter Wikipedia.org...
 
Top-Level-Domain
Jeder Name einer Domain im Internet besteht aus einer Folge von durch Punkte getrennten Zeichen. Die Bezeichnung Top-Level-Domain (vom englischen top level domain, übersetzt Bereich oberster Ebene; Abkürzung TLD) bezeichnet dabei den letzten Namen dieser Folge und stellt die höchste Ebene der Namensauflösung dar. Ist der vollständige Domain-Name eines Rechners bzw. einer Website beispielsweise de.wikipedia.org, so entspricht das rechte Glied (org) der Top-Level-Domain dieses Namens.
Mehr unter Wikipedia.org...

Dieser Eintrag beinhaltet Material aus Wikipedia® und ist lizensiert auf GNU-Lizenz für freie Dokumentation

Polska Wikipedia – Darmowa encyklopediaDownload this dictionary
travel
.travel - internetowa domena najwyższego poziomu przeznaczona dla biur podróży, linii lotniczych, hoteli, tourism itp; została utworzona 8 kwietnia 2005 roku.
W celu uzyskania więcej informacji, zobacz w Wikipedia.οrg...
 
Podróz
Podróż (z łaciny zwana peregrynacją, z francuskiego wojażem) – zmiana miejsca pobytu na odległe. Osoba podróżująca pieszo to wędrowiec, podróżujący środkiem komunikacji to podróżny lub wojażer.Podróże odbywano od dawna, zrazu dla praktycznego celu: nauki, handlu, polityki (poselstwa). Podróżowano również do miejsc kultu religijnego: z chęci odpokutowania za grzechy, zjednania łask lub w podzięce za nie. Podróż dla odwiedzenia miejsc kultu religijnego nazywa się pielgrzymką, a osoba biorąca udział w pielgrzymce to pielgrzym lub pątnik. W okresie odrodzenia (XV-XVI wiek) zaczęto podróżować dla przyjemności i poznania świata. Podróżnicy spisywali swoje przeżycia, opisywali przemierzane krainy i zwyczaje ludów je zamieszkujących. Te notatki i pamiętniki były często publikowane i stanowiły dla współczesnych cenne źródło wiedzy o świecie.
W celu uzyskania więcej informacji, zobacz w Wikipedia.οrg...

© W niniejszym artykule wykorzystano materialy pochodzace z Wikipedia® i posiada on Powszechna Licencje Publiczna GNU
Wikipedia Italiano L'enciclopedia liberaDownload this dictionary
travel
.travel è un  dominio di primo livello generico, introdotto nel 2005. Attualmente il registro è tenuto dalla Tralliance Corporation. Questo dominio è stato creato appositamente per le agenzie di viaggiooperatori turisticibed and breakfast o altre aziende comunque connesse con il turismo.Assieme a .museum sono i domini di primo livello attivi più lunghi.
Per saperne di più visita Wikipedia.org...

Questo articolo utilizza materiale tratto da Wikipedia® ed è autorizzato sotto la licenza GNU Free Documentation License

Define travel

Translate travel





travel in Chinese | | travel in English | travel in French | travel in Italian | travel in Spanish | travel in Dutch | travel in Portuguese | travel in German | travel in Russian | travel in Japanese | travel in Greek | travel in Korean | travel in Turkish | travel in Hebrew | travel in Arabic | travel in Thai | travel in Other Eastern-European languages | travel in Other Western-European languages | travel in Other Russian languages | travel in Other Turkish dialects | travel in Polish | travel in Hungarian | travel in Czech | travel in Latvian | travel in Catalan | travel in Croatian | travel in Serbian | travel in Albanian | travel in Urdu | travel in Slovenian | travel in Estonian | travel in Bulgarian | travel in Danish | travel in Finnish | travel in Norwegian | travel in Romanian | travel in Swedish | travel in Ukrainian | travel in Farsi | travel in Macedonian | travel in Afrikaans | travel in Hindi